| Key Annotation | Summary | Canonical Classes | Structure | Germline View | Humanize | Library |
|
Not numbered Not numbered
Amino Acid Sequence: IGPSRPRHTMFYHHQYKYLRPPRAPSLEPGGSSPYSSYYRRRQRLHRRVSETLQPAPSLP
PTPRAATGPAGPRVMA |
| Key Annotation | Summary | Canonical Classes | Structure | Germline View | Humanize | Library |
|
Not numbered Not numbered
Amino Acid Sequence: IGPSRPRHTMFYHHQYKYLRPPRAPSLEPGGSSPYSSYYRRRQRLHRRVSETLQPAPSLP
PTPRAATGPAGPRVMA |